The human immune system carries its own broad-spectrum antibiotic. It is a single 37-amino-acid peptide called LL-37. What follows is for research use only: LL-37 is studied in cell culture and animal models, not used in self-experimentation, and the discussion here is educational, not medical.
LL-37 belongs to a small group of host-defense molecules called cathelicidins, and in humans it is the only one we make. The same short sequence that wrecks bacterial membranes also helps coordinate the innate immune response, signals to skin and gut cells during repair, and shows up in cell-culture studies of cancer biology. One short peptide, many roles — which is exactly why LL-37 is one of the most-cited antimicrobial peptides in the research literature.
This explainer walks through where LL-37 comes from, how it acts on bacterial membranes, what else it does in cell-culture systems, how researchers actually study it, and why engineered LL-37 analogs are now an active scientific direction.
Where LL-37 comes from
The short version: humans build LL-37 from a longer precursor protein and keep it on standby inside immune cells and at body surfaces, ready for release when something goes wrong.
The CAMP gene and the hCAP-18 precursor
LL-37 is encoded by the CAMP gene on human chromosome 3p21. The gene doesn't produce the active peptide directly. It produces a larger precursor called hCAP-18 — an 18-kilodalton protein with a signal sequence at one end, a conserved "cathelin-like" pro-domain in the middle, and the antimicrobial sequence tucked at the C-terminus. When the cell needs to release the active peptide, the enzyme proteinase 3 cleaves hCAP-18, freeing the 37 amino acids that become LL-37. Because LL-37 is the only cathelicidin found in humans, it makes an unusually clean system to study.
Where it is made and stored
The peptide is held in the secretory granules of neutrophils and macrophages — the white blood cells that arrive first at sites of infection. Skin keratinocytes also produce it, as do the epithelial cells lining the gut, lungs, and other mucosal surfaces. Expression goes up during inflammation, during barrier damage, and in response to vitamin D signaling. Those connections have driven a wave of research into the peptide's role in skin health and innate immunity.
The sequence itself
The mature peptide is 37 amino acids long. It begins with two leucines — hence the "LL". Its sequence — [LL-37, 37 aa] — carries a net positive charge of roughly +6 at physiological pH. In water it is mostly disordered. Near a membrane, it folds into an amphipathic alpha-helix: one face of the helix is hydrophobic, the other is studded with cationic residues. That two-faced character is the structural basis of everything that follows.
How LL-37 works on bacterial membranes
Most antibiotics target a specific bacterial enzyme. LL-37 does something cruder, and harder to evolve resistance against: it goes after the bacterial membrane itself.
The amphipathic alpha-helix
Bacterial membranes look chemically different from the membranes of mammalian cells. Their outer leaflet is rich in negatively charged phospholipids like phosphatidylglycerol and cardiolipin. The cationic face of LL-37 is electrostatically drawn to that anionic surface. Once docked, the hydrophobic face slides into the lipid bilayer — like a hand sliding sideways into a sheaf of papers.
Oligomerization, not classical pores
Early models pictured antimicrobial peptides forming neat barrel-stave pores. The most recent structural work suggests LL-37 is messier and more interesting than that. A 2020 crystallographic study in Scientific Reports showed LL-37 dimerizes in solution as anti-parallel helices, then remodels into higher-order oligomers when it meets a membrane mimic. The activated oligomer — closer to a fibril than to a pore — appears to be the species that actually does the damage, polymerizing on the surface and extracting bacterial lipids.
Solid-state NMR in phospholipid model membranes points in a complementary direction. The peptide orients with its helical axis approximately parallel to the membrane surface and disrupts bilayer integrity through a carpet-like accumulation rather than a discrete transmembrane channel. Above a critical surface density, the membrane gives way.
Membrane selectivity
If LL-37 wrecks any membrane it touches, why aren't the cells that produce it destroyed? Selectivity comes from chemistry. Mammalian cell membranes are dominated by zwitterionic phosphatidylcholine and reinforced with cholesterol. They don't recruit the peptide as aggressively, and they suppress the oligomerization step. At moderate concentrations, LL-37 hits bacteria much harder than it hits the cells that made it. At very high concentrations that window closes — a fact that drives much of the engineering work on LL-37 analogs.
What LL-37 does beyond killing microbes
Direct membrane disruption is only half of why researchers care about LL-37. The peptide also talks to the immune system, to skin and gut cells, and to other host tissues.
Immunomodulation
LL-37 binds and neutralizes bacterial lipopolysaccharide (LPS) — the molecule on Gram-negative bacteria that drives much of the immune system's overreaction during severe infection. It is also a chemoattractant: it recruits neutrophils and T cells to sites of damage. And it modulates how immune cells release cytokines. But there is a twist.
A 2023 study in human cell co-cultures showed that at low physiological concentrations LL-37 only activates monocytes when polarized epithelial cells are present, through MAPK/ERK signaling. In isolation, low-concentration LL-37 produced little response. The finding nuances older work that used much higher peptide concentrations, and reframes LL-37 as a context-dependent signal — not a constitutively active cytokine inducer.
Wound-healing-related activity in cell culture
In scratch-wound assays on cultured human keratinocytes, LL-37 promotes cell migration through actin cytoskeleton remodeling and increased tyrosine phosphorylation of focal-adhesion proteins. In porcine wound models the peptide accelerated re-epithelialization. The work points to a coordinated role in tissue repair: clear the wound of microbes first, then push the surrounding cells to migrate and close the gap.
Effects in other cell-culture systems
Two other strands of the literature are worth knowing about. First, in a RANKL-driven osteoclast differentiation assay, LL-37 inhibits osteoclastogenesis by blocking the calcineurin–NFAT2 signaling axis, suggesting roles in bone-biology research models. Second, several reviews have explored LL-37 and engineered LL-37 mimics as candidate research-stage anticancer peptides, on the basis that cancer-cell membranes often expose more anionic phosphatidylserine than healthy cells — a target the peptide recognizes. Those effects are context-dependent. In some tumor systems LL-37 expression appears tumor-promoting; in others it is suppressive. The work is preclinical.
How researchers study LL-37 in the lab
The methods toolkit for LL-37 looks very similar to the one researchers use for other peptides — which is to say, mostly cell-culture and biophysics. For a broader tour, see our piece on in-vitro assays researchers use to study peptides.
Standard in-vitro toolkit
The antimicrobial side is dominated by minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) assays against panels of Gram-positive and Gram-negative bacteria, including drug-resistant clinical isolates like MRSA. Biofilm assays add a layer of realism for chronic-wound–relevant species. To characterize the therapeutic window of any LL-37 derivative, researchers run mammalian cell-line viability tests and red-blood-cell hemolysis assays in parallel.
The mechanistic side relies on biophysics. Circular-dichroism spectroscopy confirms helical folding. Fluorescence assays track membrane binding. X-ray crystallography or solid-state NMR resolves the structure of the peptide in a membrane-mimic environment. Each method asks a slightly different question about how the peptide interacts with cellular targets.
Reading the literature carefully
Two notes for anyone reading LL-37 papers. First, concentration matters. Many older studies used micromolar peptide concentrations far above what circulates in healthy tissue, and the immune effects observed at those concentrations may not generalize down to physiological levels. Second, LL-37 from different research suppliers can vary in purity, truncation, and chemical modification. Purity reporting isn't a footnote. It's a precondition for reproducibility.
LL-37 analogs and the engineering question
If native LL-37 is a useful research compound but also hemolytic at higher concentrations and degradable by serum proteases, the obvious question is whether a redesigned version could keep the antimicrobial activity while shrinking the unwanted effects. A growing literature says yes — at least in laboratory systems.
Why redesign a natural peptide?
Three reasons drive the engineering work. Native LL-37 is cytotoxic to mammalian cells at high concentrations. It is sensitive to serum protease activity, which limits its stability in many experimental contexts. And its 37-amino-acid length is longer than necessary for many of its activities, which raises the cost of synthesis.
What engineered LL-37 peptides have shown in research
Recent work on LL-37-derived synthetic peptides screened a panel of truncations and substitution variants against planktonic and biofilm Staphylococcus aureus, including MRSA isolates. Several variants retained or improved antibacterial activity while showing reduced hemolytic effects compared with full-length LL-37, supporting LL-37-derived peptides as a research-stage scaffold for further antimicrobial peptide work. In parallel, mimic peptides built on the LL-37 backbone have shown selective activity against cancer cell lines in vitro.
Why LL-37 is interesting to researchers (not consumers)
One important caveat carries through everything above. LL-37 is a research compound. There is no LL-37 medical product approved by the U.S. FDA. Engineered LL-37 analogs sit at preclinical or early-stage research interest, not clinical availability. For a longer discussion of the distinction between a peptide as a research material and as a pharmaceutical product, see our note on research-grade vs pharmacy-grade peptides.
The reasons researchers and chemists pay close attention to LL-37 are scientific, not consumer-facing. The peptide is the cleanest available model for understanding how short cationic host-defense peptides recognize bacterial membranes. It is the most-cited scaffold for engineered antimicrobial peptide design. And it is one of the few peptides where direct antimicrobial activity, immune signaling, and tissue-repair biology meet in a single short sequence.
Frequently Asked Questions
What does LL-37 stand for?
The "LL" refers to the two leucine residues at the peptide's N-terminus, and "37" is the number of amino acids in the mature, active sequence. The peptide is the C-terminal antimicrobial fragment cleaved from a larger precursor protein, hCAP-18, encoded by the human CAMP gene.
Is LL-37 produced naturally in the human body?
Yes. LL-37 is the only cathelicidin antimicrobial peptide humans make. It is stored in neutrophils and macrophages and is also produced by epithelial cells at mucosal surfaces and in the skin. It is released from the hCAP-18 precursor as part of the innate immune response.
Why is LL-37 of interest to researchers?
LL-37 sits at an unusual intersection of broad-spectrum antimicrobial activity — against bacteria, fungi, parasites, and enveloped viruses — and immune signaling, including LPS neutralization, cytokine modulation, and chemotaxis. Researchers study it as a model for host-defense peptide biology and as a starting scaffold for engineered antimicrobial peptide analogs.
Is LL-37 the same as a pharmaceutical drug?
No. LL-37 itself is not an FDA-approved drug. It is a human endogenous peptide studied in laboratory research. Engineered LL-37-derived peptides are in preclinical or early-stage research investigations, but none are approved medical products at the time of writing.
Conclusion
LL-37 is a small molecule with an outsized scientific footprint. A single 37-amino-acid sequence, encoded by one gene and processed from one precursor protein, links three distinct strands of biology: direct antimicrobial action on bacterial membranes, context-dependent immune signaling, and tissue-repair biology in skin and other epithelial systems. It is also the leading scaffold in an active engineering effort to build the next generation of antimicrobial peptides.
The practical answers about toxicity, stability, and selectivity of LL-37 and its analogs are still being worked out, mostly in cell culture and animal models. For anyone reading the literature, the most useful framing is that LL-37 is a research compound and a model peptide — interesting because of what it teaches about host-defense biology, not because it is a finished product.
For research use only. Not for human or animal consumption of any kind. The information in this article is for educational purposes only and is not intended to diagnose, treat, cure, or prevent any disease. The statements made have not been evaluated by the U.S. Food and Drug Administration. These products are NOT FDA APPROVED. Please consult with a licensed healthcare professional before making any decisions regarding your health or research.
Optides LLC is a chemical supplier. Optides LLC is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic Act. Optides LLC is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic Act.

